Recombinant Human KRT8 protein, GST-tagged

Cat.No. : KRT8-301413H
Product Overview : Recombinant Human KRT8 (11-50 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Human
Tag : GST
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Protein length : Glu11-Leu50
AA Sequence : EGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNSRSL
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name KRT8 keratin 8 [ Homo sapiens ]
Official Symbol KRT8
Synonyms KRT8; keratin 8; keratin, type II cytoskeletal 8; CARD2; CK8; CYK8; K2C8; K8; KO; cytokeratin 8; cytokeratin-8; type-II keratin Kb8; CK-8;
Gene ID 3856
mRNA Refseq NM_001256282
Protein Refseq NP_001243211
MIM 148060
UniProt ID P05787

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All KRT8 Products

Required fields are marked with *

My Review for All KRT8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon