Recombinant Human KRT71 Protein, GST-tagged
Cat.No. : | KRT71-4844H |
Product Overview : | Human KRT6IRS partial ORF ( NP_258259.1, 251 a.a. - 332 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into epithelial keratins and hair keratins. This gene encodes a protein that is expressed in the inner root sheath of hair follicles. The type II keratins are clustered in a region of chromosome 12q13 |
Molecular Mass : | 34.76 kDa |
AA Sequence : | LQAKVESMDQEIKFFRCLFEAEITQIQSHISDMSVILSMDNNRNLDLDSIIDEVRTQYEEIALKSKAEAEALYQTKFQELQL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KRT71 keratin 71 [ Homo sapiens ] |
Official Symbol | KRT71 |
Synonyms | KRT71; keratin 71; keratin, type II cytoskeletal 71; K6IRS1; KRT6IRS; KRT6IRS1; K71; CK-71; hK6irs; hK6irs1; keratin-71; keratin 6 irs; cytokeratin-71; type-II keratin Kb34; type II inner root sheath-specific keratin-K6irs1; MGC119390; MGC119391; |
Gene ID | 112802 |
mRNA Refseq | NM_033448 |
Protein Refseq | NP_258259 |
MIM | 608245 |
UniProt ID | Q3SY84 |
◆ Recombinant Proteins | ||
Krt71-1433M | Recombinant Mouse Krt71 protein, His-tagged | +Inquiry |
KRT71-4935M | Recombinant Mouse KRT71 Protein, His (Fc)-Avi-tagged | +Inquiry |
KRT71-8847M | Recombinant Mouse KRT71 Protein | +Inquiry |
KRT71-4844H | Recombinant Human KRT71 Protein, GST-tagged | +Inquiry |
KRT71-881H | Recombinant Human KRT71 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KRT71 Products
Required fields are marked with *
My Review for All KRT71 Products
Required fields are marked with *
0
Inquiry Basket