Recombinant Human KRT71 Protein, GST-tagged

• Cat.No.: KRT71-4844H
• Product Overview: Human KRT6IRS partial ORF ( NP_258259.1, 251 a.a. - 332 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into epithelial keratins and hair keratins. This gene encodes a protein that is expressed in the inner root sheath of hair follicles. The type II keratins are clustered in a region of chromosome 12q13
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 34.76 kDa
• AA Sequence: LQAKVESMDQEIKFFRCLFEAEITQIQSHISDMSVILSMDNNRNLDLDSIIDEVRTQYEEIALKSKAEAEALYQTKFQELQL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KRT71 keratin 71 [ Homo sapiens ]
• Official Symbol: KRT71
• Synonyms: KRT71; keratin 71; keratin, type II cytoskeletal 71; K6IRS1; KRT6IRS; KRT6IRS1; K71; CK-71; hK6irs; hK6irs1; keratin-71; keratin 6 irs; cytokeratin-71; type-II keratin Kb34; type II inner root sheath-specific keratin-K6irs1; MGC119390; MGC119391
• Gene ID: 112802
• mRNA Refseq: NM_033448
• Protein Refseq: NP_258259
• MIM: 608245
• UniProt ID: Q3SY84