Recombinant Human KRT28 Protein, GST-tagged

Cat.No. : KRT28-4857H
Product Overview : Human KRT28 full-length ORF ( AAI48795.1, 1 a.a. - 464 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a member of the type I (acidic) keratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. The type I keratin genes are clustered in a region of chromosome 17q12-q21. [provided by RefSeq
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 77.99 kDa
AA Sequence : MSLQFSNGSRHVCLRSGAGSVRPLNGGAGFAGSSACGGSVAGSEFSCALGGGLGSVPGGSHAGGALGNAACIGFAGSEGGLLSGNEKVTMQNLNDRLASYLDNVRALEEANAELERKIKGWYEKYGPGSCRGLDHDYSRYHLTIEDLKNKIISSTTTNANVILQIDNARLAADDFRLKYENELTLHQNVEADINGLRRVLDELTLCRTDQELQYESLSEEMTYLKKNHEEEMKALQCAAGGNVNVEMNAAPGVDLAVLLNNMRAEYEALAEQNRKDAEAWFNEKSASLQQQISHDSGAATFARSQLTEMRRTLQTLEIQLQSLMATKHSLECSLTETESNYCTQLAQIQAQIGALEEQLHQVRTETEGQKLEYEHLLDVKVHLEKEIETYCRLIDGDGNSCSKSKGFGSGSPGNSSKDLSKTTLVKTVVEELDQRGKVLSSRIHSIEEKTSKMTNGKTEQRVPF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KRT28 keratin 28 [ Homo sapiens (human) ]
Official Symbol KRT28
Synonyms KRT28; keratin 28; KRT25D; K25IRS4; keratin, type I cytoskeletal 28; CK-28; K25D; K28; cytokeratin-28; keratin 28, type I; keratin-25D; type I inner root sheath specific keratin 25 irs4; type I inner root sheath-specific keratin-K25irs4
Gene ID 162605
mRNA Refseq NM_181535
Protein Refseq NP_853513
MIM 616677
UniProt ID Q7Z3Y7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All KRT28 Products

Required fields are marked with *

My Review for All KRT28 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon