Recombinant Human KREMEN1 Protein, GST-tagged

Cat.No. : KREMEN1-4883H
Product Overview : Human KREMEN1 partial ORF ( NP_114434, 310 a.a. - 391 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. The encoded protein is a component of a membrane complex that modulates canonical WNT signaling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains. Alternatively spliced transcript variants encoding distinct isoforms have been observed for this gene. [provided by RefSeq
Molecular Mass : 34.76 kDa
AA Sequence : INQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGSNSWAPPMGAGSHRVE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KREMEN1 kringle containing transmembrane protein 1 [ Homo sapiens ]
Official Symbol KREMEN1
Synonyms KREMEN1; kringle containing transmembrane protein 1; KREMEN, kringle containing transmembrane protein; kremen protein 1; KRM1; dickkopf receptor; kringle-coding gene marking the eye and the nose; kringle domain-containing transmembrane protein 1; kringle-containing protein marking the eye and the nose; KREMEN; FLJ31863;
Gene ID 83999
mRNA Refseq NM_001039570
Protein Refseq NP_001034659
MIM 609898
UniProt ID Q96MU8

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All KREMEN1 Products

Required fields are marked with *

My Review for All KREMEN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon