Recombinant Human KREMEN1 Protein, GST-tagged

• Cat.No.: KREMEN1-4883H
• Product Overview: Human KREMEN1 partial ORF ( NP_114434, 310 a.a. - 391 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. The encoded protein is a component of a membrane complex that modulates canonical WNT signaling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains. Alternatively spliced transcript variants encoding distinct isoforms have been observed for this gene. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 34.76 kDa
• AA Sequence: INQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGSNSWAPPMGAGSHRVE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KREMEN1 kringle containing transmembrane protein 1 [ Homo sapiens ]
• Official Symbol: KREMEN1
• Synonyms: KREMEN1; kringle containing transmembrane protein 1; KREMEN, kringle containing transmembrane protein; kremen protein 1; KRM1; dickkopf receptor; kringle-coding gene marking the eye and the nose; kringle domain-containing transmembrane protein 1; kringle-containing protein marking the eye and the nose; KREMEN; FLJ31863
• Gene ID: 83999
• mRNA Refseq: NM_001039570
• Protein Refseq: NP_001034659
• MIM: 609898
• UniProt ID: Q96MU8