Recombinant Human KRCC1 Protein, GST-tagged

• Cat.No.: KRCC1-4885H
• Product Overview: Human KRCC1 full-length ORF ( NP_057702.1, 1 a.a. - 259 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: KRCC1 (Lysine Rich Coiled-Coil 1) is a Protein Coding gene. An important paralog of this gene is ZMAT1.
• Molecular Mass: 57.4 kDa
• AA Sequence: MKHSKKTYDSFQDELEDYIKVQKARGLEPKTCFRKMKGDYLETCGYKGEVNSRPTYRMFDQRLPSETIQTYPRSCNIPQTVENRLPQWLPAHDSRLRLDSLSYCQFTRDCFSEKPVPLNFNQQEYICGSHGVEHRVYKHFSSDNSTSTHQASHKQIHQKRKRHPEEGREKSEEERSKHKRKKSCEEIDLDKHKSIQRKKTEVEIETVHVSTEKLKNRKEKKSRDVVSKKEERKRTKKKKEQGQERTEEEMLWDQSILGF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KRCC1 lysine-rich coiled-coil 1 [ Homo sapiens ]
• Official Symbol: KRCC1
• Synonyms: KRCC1; lysine-rich coiled-coil 1; lysine-rich coiled-coil protein 1; FLJ22333; cryptogenic hepatitis binding protein; cryptogenic hepatitis-binding protein 2; CHBP2
• Gene ID: 51315
• mRNA Refseq: NM_016618
• Protein Refseq: NP_057702
• UniProt ID: Q9NPI7