Recombinant Human KRAS Q61H Protein, AviTag™
Cat.No. : | KRAS-07H |
Product Overview : | Recombinant human KRAS Q61H protein (amino acids 1-185; Q61H mutant variant of isoform 2B) with the N-terminal AviTag™ peptide and His-tag is produced in E. coli cells. Presence of AviTag™ peptide can be useful for a site-specific biotinylation with BirA enzyme. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Avi |
Protein Length : | 1-185 |
Description : | Human KRAS protein is a small guanosine triphosphatase (GTPase) that is the component of the mitogen activated protein kinase (MAPK) signaling pathway. High occurrences of KRAS mutations in some types of cancers make KRAS one of the most important targets in oncology for drug development. The four most frequent KRAS mutations are G12D, G12V, G13D, and G12C. |
AA Sequence : | MGSHHHHHHHHSNGLNDIFEAQKIEWHEMTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGHEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC |
Purity : | > 90% by Coomassie staining |
Notes : | This product is for laboratory research use only. |
Storage : | Storage is recommended at -20 centigrade for longer periods of time. |
Concentration : | 1.0 mg/mL by A280 |
Storage Buffer : | 20 mM HEPES, pH 7.5, 250 mM NaCl, 1 mM MgCl2, 5 mM 2-mercapthoethanol, 10% glycerol. |
Shipping : | Product requires shipping on ice packs. |
Gene Name | KRAS KRAS proto-oncogene, GTPase [ Homo sapiens (human) ] |
Official Symbol | KRAS |
Synonyms | KRAS; KRAS proto-oncogene, GTPase; NS; NS3; OES; CFC2; RALD; K-Ras; KRAS1; KRAS2; RASK2; KI-RAS; C-K-RAS; K-RAS2A; K-RAS2B; K-RAS4A; K-RAS4B; K-Ras 2; 'C-K-RAS; c-Ki-ras; c-Ki-ras2; GTPase KRas; K-ras p21 protein; Kirsten rat sarcoma viral oncogene homolog; Kirsten rat sarcoma viral proto-oncogene; PR310 c-K-ras oncogene; c-Kirsten-ras protein; cellular c-Ki-ras2 proto-oncogene; cellular transforming proto-oncogene; oncogene KRAS2; proto-oncogene GTPase; transforming protein p21; v-Ki-ras2 Kirsten rat sarcoma 2 viral oncogene homolog; EC 3.6.5.8; KRAS Q61H |
Gene ID | 3845 |
mRNA Refseq | NM_033360 |
Protein Refseq | NP_203524 |
MIM | 190070 |
UniProt ID | P01116 |
◆ Recombinant Proteins | ||
KRAS-40HFL | Recombinant Full Length Human KRAS Protein, C-Flag-tagged | +Inquiry |
KRAS-1264H | Recombinant Human KRAS Protein, His (Fc)-Avi-tagged | +Inquiry |
KRAS-11H | Recombinant Human KRAS G12V Protein, AviTag™, Biotinylated | +Inquiry |
KRAS-66H | Recombinant Human KRAS Protein (G12C), GST-Tagged | +Inquiry |
KRAS-456HAF647 | Recombinant Human KRAS Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
KRAS-4885HCL | Recombinant Human KRAS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KRAS Products
Required fields are marked with *
My Review for All KRAS Products
Required fields are marked with *
0
Inquiry Basket