Recombinant Human KPNA4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | KPNA4-5881H |
Product Overview : | KPNA4 MS Standard C13 and N15-labeled recombinant protein (NP_002259) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The nuclear import of karyophilic proteins is directed by short amino acid sequences termed nuclear localization signals (NLSs). Karyopherins, or importins, are cytoplasmic proteins that recognize NLSs and dock NLS-containing proteins to the nuclear pore complex. The protein encoded by this gene shares the sequence similarity with Xenopus importin-alpha and Saccharomyces cerevisiae Srp1. This protein is found to interact with the NLSs of DNA helicase Q1 and SV40 T antigen. |
Molecular Mass : | 57.9 kDa |
AA Sequence : | MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQVVQVVLDGLSNILKMAEDEAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFFSSDDIDEDPSLVPEAIQGGTFGFNSSANVPTEGFQFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | KPNA4 karyopherin subunit alpha 4 [ Homo sapiens (human) ] |
Official Symbol | KPNA4 |
Synonyms | KPNA4; karyopherin alpha 4 (importin alpha 3); importin subunit alpha-4; IPOA3; MGC12217; MGC26703; QIP1; SRP3; importin alpha Q1; karyopherin subunit alpha-4; FLJ31113; |
Gene ID | 3840 |
mRNA Refseq | NM_002268 |
Protein Refseq | NP_002259 |
MIM | 602970 |
UniProt ID | O00629 |
◆ Recombinant Proteins | ||
KPNA4-272HF | Recombinant Full Length Human KPNA4 Protein Protein, GST-tagged | +Inquiry |
KPNA4-5881H | Recombinant Human KPNA4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KPNA4-29909TH | Recombinant Human KPNA4 Protein, GST-tagged | +Inquiry |
KPNA4-1811C | Recombinant Chicken KPNA4 | +Inquiry |
KPNA4-8800M | Recombinant Mouse KPNA4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KPNA4-4889HCL | Recombinant Human KPNA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KPNA4 Products
Required fields are marked with *
My Review for All KPNA4 Products
Required fields are marked with *
0
Inquiry Basket