Recombinant Human KMT2D Protein, GST-tagged

• Cat.No.: KMT2D-5389H
• Product Overview: Human MLL2 partial ORF ( NP_003473.1, 1487 a.a. - 1586 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a histone methyltransferase that methylates the Lys-4 position of histone H3. The encoded protein is part of a large protein complex called ASCOM, which has been shown to be a transcriptional regulator of the beta-globin and estrogen receptor genes. Mutations in this gene have been shown to be a cause of Kabuki syndrome. [provided by RefSeq, Oct 2010]
• Molecular Mass: 36.74 kDa
• AA Sequence: SKLEGMFPAYLQEAFFGKELLDLSRKALFAVGVGRPSFGLGTPKAKGDGGSERKELPTSQKGDDGPDIADEESRGLEGKADTPGPEDGGVKASPVPSDPE
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KMT2D lysine methyltransferase 2D [ Homo sapiens (human) ]
• Official Symbol: KMT2D
• Synonyms: KMT2D; lysine methyltransferase 2D; MLL2; myeloid/lymphoid or mixed-lineage leukemia 2; TNRC21, trinucleotide repeat containing 21; histone-lysine N-methyltransferase MLL2; ALR; CAGL114; KMT2D; MLL4; ALL1-related protein; Kabuki make-up syndrome; lysine N-methyltransferase 2B; lysine N-methyltransferase 2D; Kabuki mental retardation syndrome; trinucleotide repeat containing 21; KMS; AAD10; KMT2B; KABUK1; TNRC21
• Gene ID: 8085
• mRNA Refseq: NM_003482
• Protein Refseq: NP_003473
• MIM: 602113
• UniProt ID: O14686