Recombinant Human KLRC4 Protein, GST-tagged

• Cat.No.: KLRC4-4912H
• Product Overview: Human KLRC4 full-length ORF ( AAH17784, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. KLRC4 is a member of the NKG2 group which are expressed primarily in natural killer (NK) cells and encodes a family of transmembrane proteins characterized by a type II membrane orientation (extracellular C terminus) and the presence of a C-type lectin domain. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed on NK cells. The 3 end of the KLRC4 transcript includes the first non-coding exon found at the 5 end of the adjacent D12S2489E gene transcript. [provided by RefSeq
• Molecular Mass: 43.12 kDa
• AA Sequence: MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGNDKTYHCKGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPCIGVLEQNNFSLNRRMQKARHCGHCPEEWITYSNSCYYIGKERRTWEERVCWPVLRRTLICFL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KLRC4 killer cell lectin-like receptor subfamily C, member 4 [ Homo sapiens ]
• Official Symbol: KLRC4
• Synonyms: KLRC4; killer cell lectin-like receptor subfamily C, member 4; NKG2-F type II integral membrane protein; NKG2 F; NK cell receptor F; natual killer cell group 2-F; NKG2-F-activating NK receptor; NKG2F; NKG2-F; FLJ17759; FLJ78582
• Gene ID: 8302
• mRNA Refseq: NM_013431
• Protein Refseq: NP_038459
• MIM: 602893
• UniProt ID: O43908