Recombinant Human KLK7 protein, GST-tagged

• Cat.No.: KLK7-3139H
• Product Overview: Recombinant Human KLK7 protein(P49862)(28-253aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 28-253aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 51.7 kDa
• AA Sequence: DKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: KLK7 kallikrein-related peptidase 7 [ Homo sapiens ]
• Official Symbol: KLK7
• Synonyms: KLK7; kallikrein-related peptidase 7; kallikrein 7 (chymotryptic, stratum corneum) , PRSS6; kallikrein-7; SCCE; signal protein; serine protease 6; stratum corneum chymotryptic enzyme; kallikrein 7 (chymotryptic, stratum corneum); hK7; PRSS6
• Gene ID: 5650
• mRNA Refseq: NM_001243126
• Protein Refseq: NP_001230055
• MIM: 604438
• UniProt ID: P49862