Recombinant Human KLK7

• Cat.No.: KLK7-26893TH
• Product Overview: Recombinant fragment corresponding to amino acids 31-130 of Human Kallikrein 7 with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: This gene encodes a member of the kallikrein subfamily of serine proteases. These enzymes have diverse physiological functions and many kallikrein genes are biomarkers for cancer. The encoded protein has chymotrypsin-like activity and plays a role in the proteolysis of intercellular cohesive structures that precedes desquamation, the shedding of the outermost layer of the epidermis. The encoded protein may play a role in cancer invasion and metastasis, and increased expression of this gene is associated with unfavorable prognosis and progression of several types of cancer. Polymorphisms in this gene may play a role in the development of atopic dermatitis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, which is one of fifteen kallikrein subfamily members located in a gene cluster on chromosome 19.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Abundantly expressed in the skin and is expressed by keratinocytes in the epidermis. Also expressed in the brain, mammary gland, cerebellum, spinal cord and kidney. Lower levels in salivary glands, uterus, thymus, thyroid, placenta, trachea and testis. Up
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: IDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKK
• Sequence Similarities: Belongs to the peptidase S1 family. Kallikrein subfamily.Contains 1 peptidase S1 domain.

Gene Information

• Gene Name: KLK7 kallikrein-related peptidase 7 [ Homo sapiens ]
• Official Symbol: KLK7
• Synonyms: KLK7; kallikrein-related peptidase 7; kallikrein 7 (chymotryptic, stratum corneum) , PRSS6; kallikrein-7; SCCE
• Gene ID: 5650
• mRNA Refseq: NM_001243126
• Protein Refseq: NP_001230055
• MIM: 604438
• Uniprot ID: P49862
• Chromosome Location: 19q13.33
• Function: peptidase activity; serine-type endopeptidase activity; serine-type peptidase activity