Recombinant Human KLK5 Protein (67-293aa), C-His tagged
Cat.No. : | KLK5-3H |
Product Overview : | Recombinant human KLK5 (67-293 aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 67-293 aa |
Description : | Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its expression is up-regulated by estrogens and progestins. The encoded protein is secreted and may be involved in desquamation in the epidermis. Alternative splicing results in multiple transcript variants encoding the same protein. |
Form : | Liquid |
Molecular Mass : | 26.2 kDa (236aa) |
AA Sequence : | ADLIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANSHHHHHH |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE |
Notes : | Note: For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | KLK5 kallikrein-related peptidase 5 [ Homo sapiens (human) ] |
Official Symbol | KLK5 |
Synonyms | KLK5; kallikrein-related peptidase 5; kallikrein 5; kallikrein-5; KLK L2; SCTE; kallikrein-like protein 2; stratum corneum tryptic enzyme; KLKL2; KLK-L2 |
Gene ID | 25818 |
mRNA Refseq | NM_001077491 |
Protein Refseq | NP_001070959 |
MIM | 605643 |
UniProt ID | Q9Y337 |
◆ Recombinant Proteins | ||
KLK5-5859HF | Recombinant Full Length Human KLK5 Protein, GST-tagged | +Inquiry |
Klk5-4879M | Recombinant Mouse Klk5 Protein, His (Fc)-Avi-tagged | +Inquiry |
Klk5-7844M | Recombinant Mouse Klk5 protein, His-tagged | +Inquiry |
KLK5-2515H | Recombinant Human Kallikrein-Related Peptidase 5, His-tagged | +Inquiry |
KLK5-26H | Recombinant Human KLK5 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLK5-948HCL | Recombinant Human KLK5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KLK5 Products
Required fields are marked with *
My Review for All KLK5 Products
Required fields are marked with *
0
Inquiry Basket