Recombinant Human KLK10 protein, His-tagged

• Cat.No.: KLK10-3138H
• Product Overview: Recombinant Human KLK10 protein(O43240)(31-274aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 30.8 kDa
• Protein length: 31-274aa
• AA Sequence: AEAALLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIR
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: KLK10 kallikrein-related peptidase 10 [ Homo sapiens ]
• Official Symbol: KLK10
• Synonyms: KLK10; kallikrein-related peptidase 10; kallikrein 10 , PRSSL1; kallikrein-10; NES1; kallikrein 10; protease serine-like 1; protease, serine-like, 1; normal epithelial cell-specific 1; breast normal epithelial cell associated serine protease; PRSSL1
• Gene ID: 5655
• mRNA Refseq: NM_001077500
• Protein Refseq: NP_001070968
• MIM: 602673
• UniProt ID: O43240