Recombinant Human KLF8 protein, GST-tagged

• Cat.No.: KLF8-301536H
• Product Overview: Recombinant Human KLF8 (207-284 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Gly207-Val284
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: GGDGKNAGSVKVDPTSMSPLEIPSDSEESTIESGSSALQSLQGLQQEPAAMAQMQGEESLDLKRRRIHQCDFAGCSKV
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: KLF8 Kruppel-like factor 8 [ Homo sapiens ]
• Official Symbol: KLF8
• Synonyms: KLF8; Kruppel-like factor 8; Krueppel-like factor 8; BKLF3; DXS741; ZNF741; zinc finger protein 741; basic kruppel-like factor 3; basic krueppel-like factor 3; MGC138314; DKFZp686O08126
• Gene ID: 11279
• mRNA Refseq: NM_001159296
• Protein Refseq: NP_001152768
• MIM: 300286
• UniProt ID: O95600