Recombinant Human KLF5 protein, T7/His-tagged

Cat.No. : KLF5-133H
Product Overview : Recombinant human KLF5 cDNA (457aa, derived from BC042131) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Form : 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFATRVLSMSARLGPVPQPPAPQDEPVFAQLKPVLGAANPARDAALFP GEELKHAHHRPQAQPAPAQAPQPAQPPATGPRLPPEDLVQTRCEMEKYLTPQLPPVPIIPEHKKYRRDSASVVDQ FFTDTEGLPYSINMNVFLPDITHLRTGLYKSQRPCVTHIKTEPVAIFSHQSETTAPPPAPTQALPEFTSIFSSHQ TAAPEVNNIFIKQELPTPDLHLSVPTQQGHLYQLLNTPDLDMPSSTNQTAAMDTLNVSMSAAMAGLNTHTSAVPQ TAVKQFQGMPPCTYTMPSQFLPQQATYFPPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPTTL PVNSQNIQPVRYNRRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTR HYRKHTGAKPFQCGVCNRSFSRSDHLALHMKRHQN
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name KLF5 Kruppel-like factor 5 (intestinal) [ Homo sapiens ]
Official Symbol KLF5
Synonyms KLF5; Kruppel-like factor 5 (intestinal); BTEB2; Krueppel-like factor 5; CKLF; IKLF; BTE-binding protein 2; GC box binding protein 2; GC-box-binding protein 2; colon kruppel-like factor; colon krueppel-like factor; transcription factor BTEB2; intestinal-enriched kruppel-like factor; intestinal-enriched krueppel-like factor; basic transcription element binding protein 2; basic transcription element-binding protein 2;
Gene ID 688
mRNA Refseq NM_001730
Protein Refseq NP_001721
MIM 602903
UniProt ID Q13887
Chromosome Location 13q21.3
Pathway Adipogenesis, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Transcriptional Regulation of White Adipocyte Differentiation, organism-specific biosystem;
Function DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All KLF5 Products

Required fields are marked with *

My Review for All KLF5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon