Recombinant Human KLF3 protein, T7/His-tagged

Cat.No. : KLF3-168H
Product Overview : Recombinant human KLF3 cDNA (345aa) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFLMFDPVPVKQEAMDPVSVSYPSNYMESMKPNKYGVIYSTPLPEKFF QTPEGLSHGIQMEPVDLTVNKRSSPPSAGNSPSSLKFPSSHRRASPGLSMPSSSPPIKKYSPPSPGVQPFGVPLS MPPVMAAALSRHGIRSPGILPVIQPVVVQPVPFMYTSHLQQPLMVSLSEEMENSSSSMQVPVIESYEKPISQKKI KIEPGIEPQRTDYYPEEMSPPLMNSVSPPQALLQENHPSVIVQPGKRPLPVESPDTQRKRRIHRCDYDGCNKVYT KSSHLKAHRRTHTGEKPYKCTWEGCTWKFARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHMLV
Purity : >90% by SDS-PAGE.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name KLF3 Kruppel-like factor 3 (basic) [ Homo sapiens ]
Official Symbol KLF3
Synonyms KLF3; BKLF; TEF-2; transcript ch138; basic Kruppel-like factor; basic kruppel like factor; basic krueppel-like factor; MGC48279;
Gene ID 51274
mRNA Refseq NM_016531
Protein Refseq NP_057615
MIM 609392
UniProt ID P57682
Chromosome Location 4p16.1-p15.2
Pathway Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem;
Function DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All KLF3 Products

Required fields are marked with *

My Review for All KLF3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon