Recombinant Human KLF3 protein, T7/His-tagged
Cat.No. : | KLF3-168H |
Product Overview : | Recombinant human KLF3 cDNA (345aa) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Human |
Tag : | His&T7 |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFLMFDPVPVKQEAMDPVSVSYPSNYMESMKPNKYGVIYSTPLPEKFF QTPEGLSHGIQMEPVDLTVNKRSSPPSAGNSPSSLKFPSSHRRASPGLSMPSSSPPIKKYSPPSPGVQPFGVPLS MPPVMAAALSRHGIRSPGILPVIQPVVVQPVPFMYTSHLQQPLMVSLSEEMENSSSSMQVPVIESYEKPISQKKI KIEPGIEPQRTDYYPEEMSPPLMNSVSPPQALLQENHPSVIVQPGKRPLPVESPDTQRKRRIHRCDYDGCNKVYT KSSHLKAHRRTHTGEKPYKCTWEGCTWKFARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHMLV |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | KLF3 Kruppel-like factor 3 (basic) [ Homo sapiens ] |
Official Symbol | KLF3 |
Synonyms | KLF3; BKLF; TEF-2; transcript ch138; basic Kruppel-like factor; basic kruppel like factor; basic krueppel-like factor; MGC48279; |
Gene ID | 51274 |
mRNA Refseq | NM_016531 |
Protein Refseq | NP_057615 |
MIM | 609392 |
UniProt ID | P57682 |
Chromosome Location | 4p16.1-p15.2 |
Pathway | Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem; |
Function | DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity; zinc ion binding; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All KLF3 Products
Required fields are marked with *
My Review for All KLF3 Products
Required fields are marked with *
0
Inquiry Basket