Recombinant Human KLF1 Protein, His-tagged
Cat.No. : | KLF1-01H |
Product Overview : | Recombinant Human KLF1 Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a hematopoietic-specific transcription factor that induces high-level expression of adult beta-globin and other erythroid genes. The zinc-finger protein binds to the DNA sequence CCACACCCT found in the beta hemoglobin promoter. Heterozygous loss-of-function mutations in this gene result in the dominant In(Lu) blood phenotype. |
Source : | E. coli |
Species : | Human |
Tag : | His |
Molecular Mass : | 39 kDa |
AA Sequence : | MHHHHHHATAETALPSISTLTALGPFPDTQDDFLKWWRSEEAQDMGPGPPDPTEPPLHVKSEDQPGEEEDDERGADATWDLDLLLTNFSGPEPGGAPQTCALAPSEASGAQYPPPPETLGAYAGGPGLVAGLLGSEDHSGWVRPALRARAPDAFVGPALAPAPAPEPKALALQPVYPGPGAGSSGGYFPRTGLSVPAASGAPYGLLSGYPAMYPAPQYQGHFQLFRGLQGPAPGPATSPSFLSCLGPGTVGTGLGGTAEDPGVIAETAPSKRGRRSWARKRQAAHTCAHPGCGKSYTKSSHLKAHLRTHTGEKPYACTWEGCGWRFARSDELTRHYRKHTGQRPFRCQLCPRAFSRSDHLALHMKRHL |
Purity : | > 90% by SDS-PAGE and HPLC |
Applications : | MHHHHHHATAETALPSISTLTALGPFPDTQDDFLKWWRSEEAQDMGPGPPDPTEPPLHVKSEDQPGEEEDDERGADATWDLDLLLTNFSGPEPGGAPQTCALAPSEASGAQYPPPPETLGAYAGGPGLVAGLLGSEDHSGWVRPALRARAPDAFVGPALAPAPAPEPKALALQPVYPGPGAGSSGGYFPRTGLSVPAASGAPYGLLSGYPAMYPAPQYQGHFQLFRGLQGPAPGPATSPSFLSCLGPGTVGTGLGGTAEDPGVIAETAPSKRGRRSWARKRQAAHTCAHPGCGKSYTKSSHLKAHLRTHTGEKPYACTWEGCGWRFARSDELTRHYRKHTGQRPFRCQLCPRAFSRSDHLALHMKRHL |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.22 mg/mL |
Storage Buffer : | 25mM Tris, 0.15M NaCl, 10% glycerol, 1mM DTT, pH 8.0 |
Gene Name | KLF1 KLF transcription factor 1 [ Homo sapiens (human) ] |
Official Symbol | KLF1 |
Synonyms | KLF1; KLF transcription factor 1; EKLF; EKLF/KLF1; Krueppel-like factor 1; Kruppel like factor 1; erythroid Kruppel-like factor; erythroid krueppel-like transcription factor; erythroid-specific transcription factor EKLF |
Gene ID | 10661 |
mRNA Refseq | NM_006563 |
Protein Refseq | NP_006554 |
MIM | 600599 |
UniProt ID | Q13351 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All KLF1 Products
Required fields are marked with *
My Review for All KLF1 Products
Required fields are marked with *
0
Inquiry Basket