Species : |
Human |
Source : |
E.coli |
Tag : |
His |
Protein Length : |
301-578 a.a. |
Description : |
Conventional kinesin is a tetrameric molecule composed of two heavy chains and two light chains, and transports various cargos along microtubules toward their plus ends. The heavy chains provide the motor activity, while the light chains bind to various cargos. This gene encodes a member of the kinesin light chain family. It associates with kinesin heavy chain through an N-terminal domain, and six tetratricopeptide repeat (TPR) motifs are thought to be involved in binding of cargos such as vesicles, mitochondria, and the Golgi complex. Thus, kinesin light chains function as adapter molecules and not motors per se. Although previously named "kinesin 2", this gene is not a member of the kinesin-2 / kinesin heavy chain subfamily of kinesin motor proteins. Extensive alternative splicing produces isoforms with different C-termini that are proposed to bind to different cargos; however, the full-length nature and/or biological validity of most of these variants have not been determined. |
Conjugation : |
HIS |
Tissue specificity : |
Found in a variety of tissues. Mostly abundant in brain and spine. |
Form : |
Lyophilised:Reconstitute with 54 μl aqua dest. |
Storage buffer : |
Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : |
Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : |
NNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAK QLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDP NVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREF GSVDDENKPIWMHAEEREECKGKQKDGTSFGEYGGWYK ACKVDSPTVTTTLKNLGALYRRQGKFEAAETLEEAAMRSR KQGLDNVHKQRVAEVLNDPENMEKRRSRESLNVDVVKY ESGPDGGEEVSMSVEWNGDGTGSLKRSGSFSKLRASIR RSSEKLVR |
Sequence Similarities : |
Belongs to the kinesin light chain family.Contains 6 TPR repeats. |