Recombinant Human KIR2DS3 Protein (22-245 aa), His-tagged

• Cat.No.: KIR2DS3-2461H
• Product Overview: Recombinant Human KIR2DS3 Protein (22-245 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 22-245 aa
• Description: Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 26.7 kDa
• AA Sequence: HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: KIR2DS3 killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 3 [ Homo sapiens (human) ]
• Official Symbol: KIR2DS3
• Synonyms: KIR2DS3; NKAT7
• Gene ID: 3808
• mRNA Refseq: NM_012313
• Protein Refseq: NP_036445
• UniProt ID: Q14952