Recombinant Human KIR2DL5A protein(22-238aa), His&Myc-tagged

• Cat.No.: KIR2DL5A-5930H
• Product Overview: Recombinant Human KIR2DL5A protein(Q8N109)(22-238aa), fused with N-terminal His&C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 22-238aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 30.7 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: HEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVNGTFQADFPLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRH

Gene Information

• Gene Name: KIR2DL5A killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 5A [ Homo sapiens ]
• Official Symbol: KIR2DL5A
• Synonyms: KIR2DL5A; killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 5A; CD158F; KIR2DL5; KIR2DL5.1
• Gene ID: 554278
• MIM: 605305
• UniProt ID: Q8N109