Recombinant Human KIR2DL4 Protein, His-tagged

• Cat.No.: KIR2DL4-197H
• Product Overview: Recombinant Human KIR2DL4, transcript variant 2, fused with His tag at C-terminal was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Description: Receptor on natural killer (NK) cells for HLA-C alleles. Inhibits the activity of NK cells thus preventing cell lysis.
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.4
• Molecular Mass: 25.34kD
• AA Sequence: WAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRTGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDASDPLPVSVTGNPSSSWPSPTEPSFKTGIARHLHVDHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: KIR2DL4 killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4 [ Homo sapiens ]
• Official Symbol: KIR2DL4
• Synonyms: KIR2DL4; killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4; killer cell immunoglobulin-like receptor 2DL4; 15.212; 103AS; CD158D; KIR-103AS; NK cell receptor; killer Ig receptor; CD158 antigen-like family member D; MHC class I NK cell receptor KIR103AS; killer cell inhibitory receptor 103AS; natural killer cell inhibitory receptor; G9P; KIR103; KIR103AS
• Gene ID: 3805
• mRNA Refseq: NM_001080770
• Protein Refseq: NP_001074241
• MIM: 604945
• UniProt ID: Q99706