Recombinant Human KIF20B Protein, GST-tagged

• Cat.No.: KIF20B-5496H
• Product Overview: Human MPHOSPH1 partial ORF ( NP_057279, 1671 a.a. - 1780 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: KIF20B (Kinesin Family Member 20B) is a Protein Coding gene. Among its related pathways are Response to elevated platelet cytosolic Ca2+ and Golgi-to-ER retrograde transport. GO annotations related to this gene include ATPase activity and microtubule motor activity. An important paralog of this gene is KIF20A.
• Molecular Mass: 37.84 kDa
• AA Sequence: RSQASIIGVNLATKKKEGTLQKFGDFLQHSPSILQSKAKKIIETMSSSKLSNVEASKENVSQPKRAKRKLYTSEISSPIDISGQVILMDQKMKESDHQIIKRRLRTKTAK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KIF20B kinesin family member 20B [ Homo sapiens (human) ]
• Official Symbol: KIF20B
• Synonyms: KIF20B; kinesin family member 20B; CT90; MPP1; KRMP1; MPP-1; MPHOSPH1; kinesin-like protein KIF20B; M-phase phosphoprotein 1; cancer/testis antigen 90; kinesin-related motor interacting with PIN1; mitotic kinesin-like protein; mitotic kinesin-related protein
• Gene ID: 9585
• mRNA Refseq: NM_001284259
• Protein Refseq: NP_001271188
• MIM: 605498
• UniProt ID: Q96Q89