Recombinant Human KIF20B Protein, GST-tagged

Cat.No. : KIF20B-5496H
Product Overview : Human MPHOSPH1 partial ORF ( NP_057279, 1671 a.a. - 1780 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : KIF20B (Kinesin Family Member 20B) is a Protein Coding gene. Among its related pathways are Response to elevated platelet cytosolic Ca2+ and Golgi-to-ER retrograde transport. GO annotations related to this gene include ATPase activity and microtubule motor activity. An important paralog of this gene is KIF20A.
Molecular Mass : 37.84 kDa
AA Sequence : RSQASIIGVNLATKKKEGTLQKFGDFLQHSPSILQSKAKKIIETMSSSKLSNVEASKENVSQPKRAKRKLYTSEISSPIDISGQVILMDQKMKESDHQIIKRRLRTKTAK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KIF20B kinesin family member 20B [ Homo sapiens (human) ]
Official Symbol KIF20B
Synonyms KIF20B; kinesin family member 20B; CT90; MPP1; KRMP1; MPP-1; MPHOSPH1; kinesin-like protein KIF20B; M-phase phosphoprotein 1; cancer/testis antigen 90; kinesin-related motor interacting with PIN1; mitotic kinesin-like protein; mitotic kinesin-related protein
Gene ID 9585
mRNA Refseq NM_001284259
Protein Refseq NP_001271188
MIM 605498
UniProt ID Q96Q89

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All KIF20B Products

Required fields are marked with *

My Review for All KIF20B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon