Recombinant Human KIF19 protein, His-tagged
Cat.No. : | KIF19-363H |
Product Overview : | Recombinant Human KIF19 protein(1-307 aa), fused to His tag, was expressed from E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-307 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MKDSGDSKDQQLMVALRVRPISVAELEEGATLIAHKVDEQMVVLMDPMEDPDDILRAHRSREKSYLFDVAFDFTATQEMVYQATTKSLIEGVISGYNATVFAYGPTGCGKTYTMLGTDQEPGIYVQTLNDLFRAIEETSNDMEYEVSMSYLEIMQLLMKGNRQRTQEPTAANQTSSRSHAVLQVTVRQRSRVKNILQEVRQGRLFMIDLAGSERASQTQNRGQRMKEGAHINRSLLALGNCINALSDKGSNKYINYRDSKLTRLLKDSLGGNSRTVMIAHISPASSAFEESRNTLTYAGQAKNIKTR |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | KIF19 kinesin family member 19 [ Homo sapiens ] |
Official Symbol | KIF19 |
Synonyms | KIF19; kinesin family member 19; kinesin-like protein KIF19; FLJ37300; KIF19A; |
Gene ID | 124602 |
mRNA Refseq | NM_153209 |
Protein Refseq | NP_694941 |
UniProt ID | Q2TAC6 |
◆ Recombinant Proteins | ||
KIF19-362H | Recombinant Human KIF19, GST-tagged | +Inquiry |
KIF19-363H | Recombinant Human KIF19 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIF19-926HCL | Recombinant Human KIF19 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KIF19 Products
Required fields are marked with *
My Review for All KIF19 Products
Required fields are marked with *
0
Inquiry Basket