Recombinant Human KIDINS220, His-tagged

Cat.No. : KIDINS220-26700TH
Product Overview : Recombinant fragment, corresponding to amino acids 1604-1771 of Human Kidins220 with an N terminal His tag.MW 38 kDa ;
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1604-1771 a.a.
Conjugation : HIS
Tissue specificity : Abundant in developing and adult neural tissues as well as neuroendocrine cells and dendritic cells. Overexpressed in melanoma and melanoma cell lines.
Form : Lyophilised:Reconstitute with 78 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ADDSQLEKANLIELEDDSHSGKRGIPHSLSGLQDPIIARM SICSEDKKSPSECSLIASSPEENWPACQKAYNLNRTPS TVTLNNNSAPANRANQNFDEMEGIRETSQVILRPSSSP NPTTIQNENLKSMTHKRSQRSSYTRLSKDPPELHAAASSE STGFGEERESIL
Sequence Similarities : Contains 12 ANK repeats.Contains 1 KAP NTPase domain.
Gene Name KIDINS220 kinase D-interacting substrate, 220kDa [ Homo sapiens ]
Official Symbol KIDINS220
Synonyms KIDINS220; kinase D-interacting substrate, 220kDa; kinase D-interacting substrate of 220 kDa; ankyrin repeat rich membrane spanning protein; ARMS;
Gene ID 57498
mRNA Refseq NM_020738
Protein Refseq NP_065789
Uniprot ID Q9ULH0
Chromosome Location 2p24
Pathway ARMS-mediated activation, organism-specific biosystem; NGF signalling via TRKA from the plasma membrane, organism-specific biosystem; Neurotrophin signaling pathway, organism-specific biosystem; Neurotrophin signaling pathway, conserved biosystem; Prolonged ERK activation events, organism-specific biosystem;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All KIDINS220 Products

Required fields are marked with *

My Review for All KIDINS220 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon