Recombinant Human KIAA0649 protein, His-tagged
Cat.No. : | KIAA0649-4003H |
Product Overview : | Recombinant Human KIAA0649 protein(), fused to His tag, was expressed in E. coli. |
Availability | February 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | VSSDDSFEQSIRAEIEQFLNEKRQHETQKCDGSVEKKPDTNENSAKSLLKSHQEPPTKVVHRQGLLGVQKEFAFRKPPRLAKMNVQPRSLRSKVTTTQENEGSTKPATPCRPSEAAQNKGGIKRSASAARRGKRVMSAAQASEASDSSSDDGIEEAIQLYQLQKTRKEADGDLPQRVQLREERAPDPPAHSTSSATKSALPETHRKTPSKKKLVATKTMDPGPGGLDTDHAPKLLKETKAP |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
◆ Native Proteins | ||
AZU1-26565TH | Native Human AZU1 | +Inquiry |
Progesterone-01H | Native Human Progesterone | +Inquiry |
APOC2-27332TH | Native Human APOC2 | +Inquiry |
Lectin-1818P | Active Native Peanut Lectin Protein | +Inquiry |
GPT-5344H | Native Human Glutamic-Pyruvate Transaminase (alanine aminotransferase) | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYP-1313HCL | Recombinant Human SYP 293 Cell Lysate | +Inquiry |
IL18RAP-1353CCL | Recombinant Cynomolgus IL18RAP cell lysate | +Inquiry |
TBC1D20-1740HCL | Recombinant Human TBC1D20 cell lysate | +Inquiry |
HYI-5322HCL | Recombinant Human HYI 293 Cell Lysate | +Inquiry |
ZNF654-32HCL | Recombinant Human ZNF654 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KIAA0649 Products
Required fields are marked with *
My Review for All KIAA0649 Products
Required fields are marked with *
0
Inquiry Basket