Recombinant Human KI67 protein, GST-tagged
Cat.No. : | KI67-301369H |
Product Overview : | Recombinant Human KI67 (1201-1300 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Ala1201-Lys1300 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | AGTLPGSKRQLQTPKEKAQALEDLAGFKELFQTPGHTEELVAAGKTTKIPCDSPQSDPVDTPTSTKQRPKRSIRKADVEGELLACRNLMPSAGKAMHTPK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | MKI67 marker of proliferation Ki-67 [ Homo sapiens (human) ] |
Official Symbol | KI67 |
Synonyms | MKI67; KIA; MIB-; MIB-1; PPP1R105 |
Gene ID | 4288 |
mRNA Refseq | NM_001145966 |
Protein Refseq | NP_001139438 |
MIM | 176741 |
UniProt ID | P46013 |
◆ Recombinant Proteins | ||
KI67-9382H | Recombinant Human KI67 protein, His-tagged | +Inquiry |
KI67-301369H | Recombinant Human KI67 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KI67 Products
Required fields are marked with *
My Review for All KI67 Products
Required fields are marked with *
0
Inquiry Basket