Recombinant Human KHSRP protein, GST-tagged
Cat.No. : | KHSRP-893H |
Product Overview : | Recombinant Human KHSRP(151 a.a. - 239 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 151-239 a.a. |
Description : | The KHSRP gene encodes a multifunctional RNA-binding protein implicated in a variety of cellular processes, including transcription, alternative pre-mRNA splicing, and mRNA localization. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 35.53 kDa |
AA Sequence : | VPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHD NANGGQNGTVQEIM |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | KHSRP KH-type splicing regulatory protein [ Homo sapiens ] |
Official Symbol | KHSRP |
Synonyms | KHSRP; KH-type splicing regulatory protein; far upstream element-binding protein 2; FBP2; FUBP2; FUSE binding protein 2; KSRP; p75; FUSE-binding protein 2; KH type-splicing regulatory protein; MGC99676; |
Gene ID | 8570 |
mRNA Refseq | NM_003685 |
Protein Refseq | NP_003676 |
MIM | 603445 |
UniProt ID | Q92945 |
Chromosome Location | 19p13.3 |
Pathway | Activation of Genes by ATF4, organism-specific biosystem; Destabilization of mRNA by KSRP, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; Gene Expression, organism-specific biosystem; PERK regulated gene expression, organism-specific biosystem; Regulation of mRNA Stability by Proteins that Bind AU-rich Elements, organism-specific biosystem; |
Function | DNA binding; RNA binding; |
◆ Recombinant Proteins | ||
Khsrp-1264M | Recombinant Mouse Khsrp Protein, MYC/DDK-tagged | +Inquiry |
KHSRP-892H | Recombinant Human KHSRP protein, MYC/DDK-tagged | +Inquiry |
KHSRP-893H | Recombinant Human KHSRP protein, GST-tagged | +Inquiry |
KHSRP-894H | Recombinant Human KHSRP protein, His-tagged | +Inquiry |
KHSRP-3247R | Recombinant Rat KHSRP Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KHSRP Products
Required fields are marked with *
My Review for All KHSRP Products
Required fields are marked with *
0
Inquiry Basket