Recombinant Human KHSRP protein, GST-tagged

• Cat.No.: KHSRP-893H
• Product Overview: Recombinant Human KHSRP(151 a.a. - 239 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Description: The KHSRP gene encodes a multifunctional RNA-binding protein implicated in a variety of cellular processes, including transcription, alternative pre-mRNA splicing, and mRNA localization.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 35.53 kDa
• AA Sequence: VPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHD NANGGQNGTVQEIM
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Protein length: 151-239 a.a.

Gene Information

• Gene Name: KHSRP KH-type splicing regulatory protein [ Homo sapiens ]
• Official Symbol: KHSRP
• Synonyms: KHSRP; KH-type splicing regulatory protein; far upstream element-binding protein 2; FBP2; FUBP2; FUSE binding protein 2; KSRP; p75; FUSE-binding protein 2; KH type-splicing regulatory protein; MGC99676
• Gene ID: 8570
• mRNA Refseq: NM_003685
• Protein Refseq: NP_003676
• MIM: 603445
• UniProt ID: Q92945
• Chromosome Location: 19p13.3
• Pathway: Activation of Genes by ATF4, organism-specific biosystem; Destabilization of mRNA by KSRP, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; Gene Expression, organism-specific biosystem; PERK regulated gene expression, organism-specific biosystem; Regulation of mRNA Stability by Proteins that Bind AU-rich Elements, organism-specific biosystem
• Function: DNA binding; RNA binding