Recombinant Human KDSR Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: KDSR-1510H
• Product Overview: KDSR MS Standard C13 and N15-labeled recombinant protein (NP_002026) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene catalyzes the reduction of 3-ketodihydrosphingosine to dihydrosphingosine. The putative active site residues of the encoded protein are found on the cytosolic side of the endoplasmic reticulum membrane. A chromosomal rearrangement involving this gene is a cause of follicular lymphoma, also known as type II chronic lymphatic leukemia. The mutation of a conserved residue in the bovine ortholog causes spinal muscular atrophy.
• Molecular Mass: 36.2 kDa
• AA Sequence: MLLLAAAFLVAFVLLLYMVSPLISPKPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEMHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSTFERLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSASKFAIRGLAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKPLETRLISETTSVCKPEQVAKQIVKDAIQGNFNSSLGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSIVRRCMMQREKSENADKTATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: KDSR 3-ketodihydrosphingosine reductase [ Homo sapiens (human) ]
• Official Symbol: KDSR
• Synonyms: KDSR; 3-ketodihydrosphingosine reductase; follicular lymphoma variant translocation 1, FVT1; 3 dehydrosphinganine reductase; DHSR; SDR35C1; short chain dehydrogenase/reductase family 35C; member 1; FVT-1; KDS reductase; 3-dehydrosphinganine reductase; follicular variant translocation protein 1; follicular lymphoma variant translocation 1; short chain dehydrogenase/reductase family 35C, member 1; FVT1; FLJ36555; FLJ92680
• Gene ID: 2531
• mRNA Refseq: NM_002035
• Protein Refseq: NP_002026
• MIM: 136440
• UniProt ID: Q06136