Recombinant Human KDM6A protein(1095-1258aa), His&Myc-tagged

• Cat.No.: KDM6A-8124H
• Product Overview: Recombinant Human KDM6A protein(O15550)(1095-1258aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 1095-1258aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 26.2 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: KWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEW

Gene Information

• Gene Name: KDM6A lysine (K)-specific demethylase 6A [ Homo sapiens ]
• Official Symbol: KDM6A
• Synonyms: KDM6A; lysine (K)-specific demethylase 6A; ubiquitously transcribed tetratricopeptide repeat, X chromosome , UTX; lysine-specific demethylase 6A; histone demethylase UTX; ubiquitously-transcribed TPR gene on the X chromosome; ubiquitously transcribed TPR protein on the X chromosome; ubiquitously-transcribed TPR protein on the X chromosome; ubiquitously transcribed tetratricopeptide repeat protein X-linked; ubiquitously transcribed X chromosome tetratricopeptide repeat protein; ubiquitously-transcribed X chromosome tetratricopeptide repeat protein; bA386N14.2 (ubiquitously transcribed X chromosome tetratricopeptide repeat protein (UTX)); UTX; KABUK2; bA386N14.2; MGC141941; DKFZp686A03225
• Gene ID: 7403
• mRNA Refseq: NM_021140
• Protein Refseq: NP_066963
• MIM: 300128
• UniProt ID: O15550