Recombinant Human KDM5A

• Cat.No.: KDM5A-29894TH
• Product Overview: Recombinant fragment of Human KDM5A / Jarid1A / RBBP2 with proprietary tag, 36.63kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: The protein encoded by this gene is a ubiquitously expressed nuclear protein. It binds directly, with several other proteins, to retinoblastoma protein which regulates cell proliferation. This protein also interacts with rhombotin-2 which functions distinctly in erythropoiesis and in T-cell leukemogenesis. Rhombotin-2 is thought to either directly affect the activity of the encoded protein or may indirectly modulate the functions of the retinoblastoma protein by binding to this protein.
• Molecular Weight: 36.630kDa inclusive of tags
• Biological activity: useful for Antibody Production and Protein Array
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HClNote: Glutathione is reduced
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVGLAMGTKDKEDEVTRRRKVTNRSDAFNMQMRQRKGTLSVNF
• Sequence Similarities: Belongs to the JARID1 histone demethylase family.Contains 1 ARID domain.Contains 1 JmjC domain.Contains 1 JmjN domain.Contains 3 PHD-type zinc fingers.

Gene Information

• Gene Name: KDM5A lysine (K)-specific demethylase 5A [ Homo sapiens ]
• Official Symbol: KDM5A
• Synonyms: KDM5A; lysine (K)-specific demethylase 5A; JARID1A, jumonji, AT rich interactive domain 1A , Jumonji, AT rich interactive domain 1A (RBBP2 like) , RBBP2, retinoblastoma binding protein 2; lysine-specific demethylase 5A
• Gene ID: 5927
• mRNA Refseq: NM_001042603
• Protein Refseq: NP_001036068
• MIM: 180202
• Uniprot ID: P29375
• Chromosome Location: 12p11
• Function: DNA binding; chromatin binding; metal ion binding; oxidoreductase activity; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen in