Recombinant Human KCTD5 protein, GST-tagged
Cat.No. : | KCTD5-3619H |
Product Overview : | Recombinant Human KCTD5 protein(1-234 aa), fused to GST tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-234 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MAENHCELLSPARGGIGAGLGGGLCRRCSAGLGALAQRPGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFLYRLCQADPDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKDKIRERDSKTSQVPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLVSIGSSYNYGNEDQAEFLCVVSKELHNTPYGTASEPSEKAKILQERGSRM |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | KCTD5 potassium channel tetramerisation domain containing 5 [ Homo sapiens ] |
Official Symbol | KCTD5 |
Synonyms | KCTD5; potassium channel tetramerisation domain containing 5; BTB/POZ domain-containing protein KCTD5; FLJ20040; |
Gene ID | 54442 |
mRNA Refseq | NM_018992 |
Protein Refseq | NP_061865 |
MIM | 611285 |
UniProt ID | Q9NXV2 |
◆ Recombinant Proteins | ||
KCTD5-8575M | Recombinant Mouse KCTD5 Protein | +Inquiry |
KCTD5-294H | Recombinant Human KCTD5, His-tagged | +Inquiry |
KCTD5-3619H | Recombinant Human KCTD5 protein, GST-tagged | +Inquiry |
KCTD5-4768M | Recombinant Mouse KCTD5 Protein, His (Fc)-Avi-tagged | +Inquiry |
KCTD5-2887R | Recombinant Rat KCTD5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCTD5-5005HCL | Recombinant Human KCTD5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCTD5 Products
Required fields are marked with *
My Review for All KCTD5 Products
Required fields are marked with *
0
Inquiry Basket