Recombinant Human KCTD1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : KCTD1-5786H
Product Overview : KCTD1 MS Standard C13 and N15-labeled recombinant protein (NP_001129677) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a protein containing a BTB (Broad-complex, tramtrack and bric a brac), also known as a POZ (POxvirus and zinc finger) protein-protein interaction domain. The encoded protein negatively regulates the AP-2 family of transcription factors and the Wnt signaling pathway. A mechanism for the modulation of Wnt signaling has been proposed in which the encoded protein enhances ubiquitination and degradation of the beta-catenin protein. Mutations in this gene have been identified in Scalp-ear-nipple (SEN) syndrome.
Molecular Mass : 29.4 kDa
AA Sequence : MSRPLITRSPASPLNNQGIPTPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPESRIGRLFDGTEPIVLDSLKQHYFIDRDGQMFRYILNFLRTSKLLIPDDFKDYTLLYEEAKYFQLQPMLLEMERWKQDRETGRFSRPCECLVVRVAPDLGERITLSGDKSLIEEVFPEIGDVMCNSVNAGWNHDSTHVIRFPLNGYCHLNSVQVLERLQQRGFEIVGSCGGGVDSSQFSEYVLRRELRRTPRVPSVIRIKQEPLDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name KCTD1 potassium channel tetramerisation domain containing 1 [ Homo sapiens (human) ]
Official Symbol KCTD1
Synonyms KCTD1; potassium channel tetramerisation domain containing 1; C18orf5; BTB/POZ domain-containing protein KCTD1; potassium channel tetramerization domain-containing protein 1; DKFZp451C132;
Gene ID 284252
mRNA Refseq NM_001136205
Protein Refseq NP_001129677
MIM 613420
UniProt ID Q719H9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All KCTD1 Products

Required fields are marked with *

My Review for All KCTD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon