Recombinant Human KCNMB3 Protein, hFc-His-tagged

Cat.No. : KCNMB3-33H
Product Overview : Recombinant Human KCNMB3 Protein(Q9NPA1)(Glu91-Ile200), fused with C-terminal hFc tag and His tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc&His
Protein Length : Glu91-Ile200
Form : Phosphate buffered saline
Storage : Store at -20 to -80°C.
Molecular Mass : 42 kDa
AA Sequence : EESTCTAIHTDIMDDWLDCAFTCGVHCHGQGKYPCLQVFVNLSHPGQKALLHYNEEAVQINPKCFYTPKCHQDRNDLLNSALDIKEFFDHKNGTPFSCFYSPASQSEDVI
Official Symbol KCNMB3
Synonyms KCNMB3; potassium large conductance calcium-activated channel, subfamily M beta member 3; KCNMB2, KCNMBL; calcium-activated potassium channel subunit beta-3; slo-beta-3; K(VCA)beta-3; BK channel subunit beta-3; maxi K channel subunit beta-3; charybdotoxin receptor subunit beta-3; calcium-activated potassium channel, subfamily M subunit beta-3; large conductance, voltage and Ca2+ activated potassium channel Maxi K beta 3 subunit; HBETA3; KCNMB2; KCNMBL; BKBETA3; SLOBETA3;
Gene ID 27094
mRNA Refseq NM_001163677
Protein Refseq NP_001157149
MIM 605222
UniProt ID Q9NPA1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All KCNMB3 Products

Required fields are marked with *

My Review for All KCNMB3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon