Recombinant Human KCNMA1 protein

• Cat.No.: KCNMA1-4378H
• Product Overview: Recombinant Human KCNMA1 protein(Q12791)(411-560aa), was expressed in E. coli

Specification

• Source: E. coli
• Species: Human
• Tag: Non
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 17.2 kDa
• Protein length: 411-560aa
• AA Sequence: VVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIA
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: KCNMA1 potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [ Homo sapiens ]
• Official Symbol: KCNMA1
• Synonyms: KCNMA1; potassium large conductance calcium-activated channel, subfamily M, alpha member 1; SLO; calcium-activated potassium channel subunit alpha-1; BK channel alpha subunit; KCa1.1; mSLO1; hSlo; k(VCA)alpha; slo homolog; slowpoke homolog; BKCA alpha subunit; maxi-K channel HSLO; stretch-activated Kca channel; calcium-activated potassium channel, subfamily M subunit alpha-1; BKTM; SLO1; MaxiK; SAKCA; SLO-ALPHA; bA205K10.1; MGC71881; DKFZp686K1437
• Gene ID: 3778
• mRNA Refseq: NM_001014797
• Protein Refseq: NP_001014797
• MIM: 600150
• UniProt ID: Q12791