Recombinant Human KCNK13 Full Length Transmembrane protein, His-tagged

• Cat.No.: KCNK13-1211H
• Product Overview: Recombinant Human KCNK13 protein(Q9HB14)(1-408aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-408aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 51.4 kDa
• AA Sequence: MAGRGFSWGPGHLNEDNARFLLLAALIVLYLLGGAAVFSALELAHERQAKQRWEERLANFSRGHNLSRDELRGFLRHYEEATRAGIRVDNVRPRWDFTGAFYFVGTVVSTIGFGMTTPATVGGKIFLIFYGLVGCSSTILFFNLFLERLITIIAYIMKSCHQRQLRRRGALPQESLKDAGQCEVDSLAGWKPSVYYVMLILCTASILISCCASAMYTPIEGWSYFDSLYFCFVAFSTIGFGDLVSSQNAHYESQGLYRFANFVFILMGVCCIYSLFNVISILIKQSLNWILRKMDSGCCPQCQRGLLRSRRNVVMPGSVRNRCNISIETDGVAESDTDGRRLSGEMISMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGAFAIMNNRLAETSGDR
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: KCNK13 potassium channel, subfamily K, member 13 [ Homo sapiens ]
• Official Symbol: KCNK13
• Synonyms: KCNK13; potassium channel, subfamily K, member 13; potassium channel subfamily K member 13; K2p13.1; THIK 1; THIK1; K2P13.1 potassium channel; tandem pore domain potassium channel THIK-1; tandem pore domain halothane-inhibited potassium channel 1; THIK-1
• Gene ID: 56659
• mRNA Refseq: NM_022054
• Protein Refseq: NP_071337
• MIM: 607367
• UniProt ID: Q9HB14