Recombinant Human KCNK1
Cat.No. : | KCNK1-28456TH |
Product Overview : | Recombinant fragment of Human KCNK1 protein with an N terminal proprietary tag. Predicted MW 33.55 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 72 amino acids |
Description : | This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity. |
Molecular Weight : | 33.550kDa inclusive of tags |
Tissue specificity : | Widely expressed with high levels in heart and brain and lower levels in placenta, lung, liver and kidney. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH |
Sequence Similarities : | Belongs to the two pore domain potassium channel (TC 1.A.1.8) family. |
Gene Name | KCNK1 potassium channel, subfamily K, member 1 [ Homo sapiens ] |
Official Symbol | KCNK1 |
Synonyms | KCNK1; potassium channel, subfamily K, member 1; potassium channel subfamily K member 1; DPK; K2p1.1; TWIK 1; |
Gene ID | 3775 |
mRNA Refseq | NM_002245 |
Protein Refseq | NP_002236 |
MIM | 601745 |
Uniprot ID | O00180 |
Chromosome Location | 1q42-q43 |
Pathway | Neuronal System, organism-specific biosystem; Potassium Channels, organism-specific biosystem; Tandem of pore domain in a weak inwardly rectifying K+ channels (TWIK), organism-specific biosystem; Tandem pore domain potassium channels, organism-specific biosystem; |
Function | inward rectifier potassium channel activity; ion channel activity; potassium channel activity; voltage-gated ion channel activity; |
◆ Cell & Tissue Lysates | ||
KCNK1-5041HCL | Recombinant Human KCNK1 293 Cell Lysate | +Inquiry |
KCNK1-223HCL | Recombinant Human KCNK1 Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCNK1 Products
Required fields are marked with *
My Review for All KCNK1 Products
Required fields are marked with *
0
Inquiry Basket