Recombinant Human KCNK1

• Cat.No.: KCNK1-28456TH
• Product Overview: Recombinant fragment of Human KCNK1 protein with an N terminal proprietary tag. Predicted MW 33.55 kDa.

Specification

• Description: This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity.
• Protein length: 72 amino acids
• Molecular Weight: 33.550kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Widely expressed with high levels in heart and brain and lower levels in placenta, lung, liver and kidney.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: ETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH
• Sequence Similarities: Belongs to the two pore domain potassium channel (TC 1.A.1.8) family.
• Tag: Non

Gene Information

• Gene Name: KCNK1 potassium channel, subfamily K, member 1 [ Homo sapiens ]
• Official Symbol: KCNK1
• Synonyms: KCNK1; potassium channel, subfamily K, member 1; potassium channel subfamily K member 1; DPK; K2p1.1; TWIK 1
• Gene ID: 3775
• mRNA Refseq: NM_002245
• Protein Refseq: NP_002236
• MIM: 601745
• Uniprot ID: O00180
• Chromosome Location: 1q42-q43
• Pathway: Neuronal System, organism-specific biosystem; Potassium Channels, organism-specific biosystem; Tandem of pore domain in a weak inwardly rectifying K+ channels (TWIK), organism-specific biosystem; Tandem pore domain potassium channels, organism-specific biosystem
• Function: inward rectifier potassium channel activity; ion channel activity; potassium channel activity; voltage-gated ion channel activity