Recombinant Human KCNJ12 protein, His-tagged

• Cat.No.: KCNJ12-3415H
• Product Overview: Recombinant Human KCNJ12 protein(182-433 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 182-433 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: AKMARPKKRAQTLLFSHNAVVALRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRVTEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLANEILWGHRFEPVLFEEKNQYKIDYSHFHKTYEVPSTPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRESEI
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: KCNJ12 potassium inwardly-rectifying channel, subfamily J, member 12 [ Homo sapiens ]
• Official Symbol: KCNJ12
• Synonyms: KCNJ12; potassium inwardly-rectifying channel, subfamily J, member 12; KCNJN1, potassium inwardly rectifying channel, subfamily J, inhibitor 1; ATP-sensitive inward rectifier potassium channel 12; hIRK1; IRK2; Kir2.2; Kir2.2v; inward rectifier K(+) channel Kir2.2; inward rectifier K(+) channel Kir2.6; inward rectifier K(+) channel Kir2.2v; potassium channel, inwardly rectifying subfamily J member 12; potassium inwardly-rectifying channel, subfamily J, inhibitor 1; hIRK; IRK-2; KCNJN1; kcnj12x; hkir2.2x; FLJ14167
• Gene ID: 3768
• mRNA Refseq: NM_021012
• Protein Refseq: NP_066292
• MIM: 602323
• UniProt ID: Q14500