Recombinant Human KCNA1

• Cat.No.: KCNA1-29199TH
• Product Overview: Recombinant fragment corresponding to amino acids 410-495 of Human Kv1.1 potassium channel with an N terminal proprietary tag; Predicted MWt 35.09 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 86 amino acids
• Description: This gene encodes a voltage-gated delayed potassium channel that is phylogenetically related to the Drosophila Shaker channel. The encoded protein has six putative transmembrane segments (S1-S6), and the loop between S5 and S6 forms the pore and contains the conserved selectivity filter motif (GYGD). The functional channel is a homotetramer. The N-terminus of the channel is associated with beta subunits that can modify the inactivation properties of the channel as well as affect expression levels. The C-terminus of the channel is complexed to a PDZ domain protein that is responsible for channel targeting. Mutations in this gene have been associated with myokymia with periodic ataxia (AEMK).
• Molecular Weight: 35.090kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: NFNYFYHRETEGEEQAQLLHVSSPNLASDSDLSRRSSSTMSKYEYMEIEEDMNNSIAHYRQVNIRTANCTTANQNCVNKSKLLTDV
• Sequence Similarities: Belongs to the potassium channel family. A (Shaker) (TC 1.A.1.2) subfamily. Kv1.1/KCNA1 sub-subfamily.

Gene Information

• Gene Name: KCNA1 potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia) [ Homo sapiens ]
• Official Symbol: KCNA1
• Synonyms: KCNA1; potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia); AEMK; potassium voltage-gated channel subfamily A member 1; HUK1; Kv1.1; MBK1; RBK1
• Gene ID: 3736
• mRNA Refseq: NM_000217
• Protein Refseq: NP_000208
• MIM: 176260
• Uniprot ID: Q09470
• Chromosome Location: 12p13
• Pathway: Neuronal System, organism-specific biosystem; Potassium Channels, organism-specific biosystem; Voltage gated Potassium channels, organism-specific biosystem
• Function: delayed rectifier potassium channel activity; potassium channel activity; potassium ion transmembrane transporter activity; voltage-gated ion channel activity