Recombinant Full Length Mouse Potassium Voltage-Gated Channel Subfamily A Member 1(Kcna1) Protein, His-Tagged
Cat.No. : | RFL29455MF |
Product Overview : | Recombinant Full Length Mouse Potassium voltage-gated channel subfamily A member 1(Kcna1) Protein (P16388) (1-495aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-495) |
Form : | Lyophilized powder |
AA Sequence : | MTVMSGENADEASTAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPN TLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFY ELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILIS IVIFCLETLPELKDDKDFTGTIHRIDNTTVIYTSNIFTDPFFIVETLCIIWFSFELVVRF FACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQEGNQKGEQATSLAILRVIRLVRVF RIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEAESHFSSIP DAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE GEEQAQLLHVSSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRTGNCTT ADQNCVNKSKLLTDV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Kcna1 |
Synonyms | Kcna1; Potassium voltage-gated channel subfamily A member 1; MBK1; MKI; Voltage-gated potassium channel subunit Kv1.1 |
UniProt ID | P16388 |
◆ Recombinant Proteins | ||
RFL16571RF | Recombinant Full Length Rat Potassium Voltage-Gated Channel Subfamily A Member 1(Kcna1) Protein, His-Tagged | +Inquiry |
KCNA1-8470M | Recombinant Mouse KCNA1 Protein | +Inquiry |
KCNA1-01H | Recombinant Human KCNA1 Protein, GST-tagged | +Inquiry |
KCNA1-6859HF | Recombinant Full Length Human KCNA1 Protein, GST-tagged | +Inquiry |
KCNA1-2820R | Recombinant Rat KCNA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNA1-5079HCL | Recombinant Human KCNA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Kcna1 Products
Required fields are marked with *
My Review for All Kcna1 Products
Required fields are marked with *
0
Inquiry Basket