Recombinant Human KBTBD10 protein, His-tagged
Cat.No. : | KBTBD10-2556H |
Product Overview : | Recombinant Human KBTBD10 protein(205-382 aa), fused to His tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 205-382 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | RTDKENRVKNLSEVFDCIRFRLMTEKYFKDHVEKDDIIKSNPDLQKKIKVLKDAFAGKLPEPSKNAAKTGAGEVNGDVGDEDLLPGYLNDIPRHGMFVKDLILLVNDTAAVAYDPTENECYLTALAEQIPRNHSSIVTQQNQIYVVGGLYVDEENKDQPLQSYFFQLDSIASEWVGLP |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | KBTBD10 kelch repeat and BTB (POZ) domain containing 10 [ Homo sapiens ] |
Official Symbol | KBTBD10 |
Synonyms | KBTBD10; kelch repeat and BTB (POZ) domain containing 10; kelch repeat and BTB domain-containing protein 10; sarcomeric muscle protein; SARCOSIN; kel-like protein 23; kelch-related protein 1; FLJ60989; |
Gene ID | 10324 |
mRNA Refseq | NM_006063 |
Protein Refseq | NP_006054 |
MIM | 607701 |
UniProt ID | O60662 |
◆ Recombinant Proteins | ||
KBTBD10-2556H | Recombinant Human KBTBD10 protein, His-tagged | +Inquiry |
KBTBD10-2818R | Recombinant Rat KBTBD10 Protein, His (Fc)-Avi-tagged | +Inquiry |
KBTBD10-8459M | Recombinant Mouse KBTBD10 Protein | +Inquiry |
KBTBD10-2356H | Recombinant Human KBTBD10 Protein, His-tagged | +Inquiry |
KBTBD10-4708M | Recombinant Mouse KBTBD10 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KBTBD10 Products
Required fields are marked with *
My Review for All KBTBD10 Products
Required fields are marked with *
0
Inquiry Basket