Recombinant Human KAT6A protein, GST-tagged

• Cat.No.: KAT6A-3219H
• Product Overview: Recombinant Human KAT6A protein(420-510 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: N-GST
• Protein length: 420-510 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AASequence: SPDGRKARGEVVDYSEQYRIRKRGNRKSSTSDWPTDNQDGWDGKQENEERLFGSQEIMTEKDMELFRDIQEQALQKVGVTGPPDPQVRCPS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage.
  After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: KAT6A K(lysine) acetyltransferase 6A [ Homo sapiens ]
• Official Symbol: KAT6A
• Synonyms: KAT6A; K(lysine) acetyltransferase 6A; MYST histone acetyltransferase (monocytic leukemia) 3 , MYST3, runt related transcription factor binding protein 2 , RUNXBP2, ZNF220; histone acetyltransferase KAT6A; Monocytic leukemia zinc finger protein; MOZ; MYST-3; zinc finger protein 220; histone acetyltransferase MYST3; MOZ, YBF2/SAS3, SAS2 and TIP60 protein 3; runt-related transcription factor binding protein 2; runt-related transcription factor-binding protein 2; MYST histone acetyltransferase (monocytic leukemia) 3; MYST3; ZNF220; RUNXBP2; MGC167033
• Gene ID: 7994
• mRNA Refseq: NM_001099412
• Protein Refseq: NP_001092882
• MIM: 601408
• UniProt ID: Q92794