Recombinant Human KAT2A protein, GST-tagged

• Cat.No.: KAT2A-2132H
• Product Overview: Recombinant Human KAT2A(1 a.a. - 837 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-837 a.a.
• Description: KAT2A, or GCN5, is a histone acetyltransferase (HAT) that functions primarily as a transcriptional activator. It also functions as a repressor of NF-kappa-B (see MIM 164011) by promoting ubiquitination of the NF-kappa-B subunit RELA (MIM 164014) in a HAT-independent manner (Mao et al., 2009 [PubMed 19339690]).
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 118.47 kDa
• AA Sequence: MAEPSQAPTPAPAAQPRPLQSPAPAPTPTPAPSPASAPIPTPTPAPAPAPAAAPAGSTGTGGPGVGSGGAGSGGD PARPGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKANETCKCNGWKNPKPPTAPRMDLQQPAANLSELCRSC EHPLADHVSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMTRPVVEGSLGSPP FEKPNIEQGVLNFVQYKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYKVNYTRWLCYCH VPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEEEIYGANSPIW ESGFTMPPSEGTQLVPRPASVSAAVVPSTPIFSPSMGGGSNSSLSLDSAGAEPMPGEKRTLPENLTLEDAKRLRV MGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQN VFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKE YHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEII KKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLAQIKSHPSA WPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFF YFKLKEGGLIDK
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: KAT2A K(lysine) acetyltransferase 2A [ Homo sapiens ]
• Official Symbol: KAT2A
• Synonyms: KAT2A; K(lysine) acetyltransferase 2A; GCN5 general control of amino acid synthesis 5 like 2 (yeast) , GCN5L2; histone acetyltransferase KAT2A; GCN5; PCAF b; STAF97; hsGCN5; lysine acetyltransferase 2A; histone acetyltransferase GCN5; general control of amino acid synthesis protein 5-like 2; General control of amino acid synthesis, yeast, homolog-like 2; GCN5 (general control of amino-acid synthesis, yeast, homolog)-like 2; hGCN5; GCN5L2; PCAF-b; MGC102791
• Gene ID: 2648
• mRNA Refseq: NM_021078
• Protein Refseq: NP_066564
• MIM: 602301
• UniProt ID: Q92830
• Chromosome Location: 17q12-q21
• Pathway: C-MYC pathway, organism-specific biosystem; E2F transcription factor network, organism-specific biosystem; Gene expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; NOTCH1 Intracellular Domain Regulates Transcription, organism-specific biosystem;
• Function: H3 histone acetyltransferase activity; chromatin binding; histone acetyltransferase activity; contributes_to histone acetyltransferase activity; histone acetyltransferase activity (H4-K12 specific); histone deacetylase binding; protein binding; transcription coactivator activity; transferase activity