Recombinant Human KAT2A, His-tagged

• Cat.No.: KAT2A-29886TH
• Product Overview: Recombinant full length Human KAT2A / GCN5 with an N termianl His tag; 477 amino acids with the tag; predicted MWt: 51.1 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 427 amino acids
• Description: KAT2A, or GCN5, is a histone acetyltransferase (HAT) that functions primarily as a transcriptional activator. It also functions as a repressor of NF-kappa-B (see MIM 164011) by promoting ubiquitination of the NF-kappa-B subunit RELA (MIM 164014) in a HAT-independent manner (Mao et al.
• Conjugation: HIS
• Molecular Weight: 51.100kDa inclusive of tags
• Tissue specificity: Expressed in all tissues tested, with most abundant expression in ovary.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.08% DTT, 40% Glycerol, 1.17% Sodium chloride, 0.03% EDTA, 0.32% Tris HCl
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGGGSNSSLSLDSAGAEPMPGEKRTLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
• Sequence Similarities: Belongs to the GCN5 family.Contains 1 bromo domain.Contains 1 N-acetyltransferase domain.

Gene Information

• Gene Name: KAT2A K(lysine) acetyltransferase 2A [ Homo sapiens ]
• Official Symbol: KAT2A
• Synonyms: KAT2A; K(lysine) acetyltransferase 2A; GCN5 general control of amino acid synthesis 5 like 2 (yeast) , GCN5L2; histone acetyltransferase KAT2A; GCN5; PCAF b
• Gene ID: 2648
• mRNA Refseq: NM_021078
• Protein Refseq: NP_066564
• MIM: 602301
• Uniprot ID: Q92830
• Chromosome Location: 17q12-q21
• Pathway: C-MYC pathway, organism-specific biosystem; E2F transcription factor network, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; HTLV-I infection, organism-specific biosystem
• Function: H3 histone acetyltransferase activity; N-acetyltransferase activity; chromatin binding; histone acetyltransferase activity; contributes_to histone acetyltransferase activity