Recombinant Human KAAG1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: KAAG1-5942H
• Product Overview: KAAG1 MS Standard C13 and N15-labeled recombinant protein (NP_851854) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: KAAG1 (Kidney Associated Antigen 1) is a Protein Coding gene. Diseases associated with KAAG1 include Sclerosing Cholangitis, Neonatal and Deafness, Autosomal Recessive 66.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 8.8 kDa
• AA Sequence: MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: KAAG1 kidney associated antigen 1 [ Homo sapiens (human) ]
• Official Symbol: KAAG1
• Synonyms: KAAG1; kidney associated antigen 1; RU2AS; kidney-associated antigen 1; RU2 antisense gene protein
• Gene ID: 353219
• mRNA Refseq: NM_181337
• Protein Refseq: NP_851854
• MIM: 608211
• UniProt ID: Q9UBP8