Recombinant Human KAAG1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : KAAG1-5942H
Product Overview : KAAG1 MS Standard C13 and N15-labeled recombinant protein (NP_851854) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : KAAG1 (Kidney Associated Antigen 1) is a Protein Coding gene. Diseases associated with KAAG1 include Sclerosing Cholangitis, Neonatal and Deafness, Autosomal Recessive 66.
Molecular Mass : 8.8 kDa
AA Sequence : MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name KAAG1 kidney associated antigen 1 [ Homo sapiens (human) ]
Official Symbol KAAG1
Synonyms KAAG1; kidney associated antigen 1; RU2AS; kidney-associated antigen 1; RU2 antisense gene protein
Gene ID 353219
mRNA Refseq NM_181337
Protein Refseq NP_851854
MIM 608211
UniProt ID Q9UBP8

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All KAAG1 Products

Required fields are marked with *

My Review for All KAAG1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon