Recombinant Human JSRP1 Protein, GST-tagged

• Cat.No.: JSRP1-4304H
• Product Overview: Human FLJ32416 partial ORF ( NP_653217.1, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The sarcoplasmic reticulum (SR) is an intracellular membrane compartment that controls intracellular calcium concentration and therefore plays a role in excitation-contraction coupling. In mouse skeletal muscle, Jp45 interacts with key proteins involved in excitation-contraction coupling at the SR (Anderson et al., 2003 [PubMed 12871958]).[supplied by OMIM
• Molecular Mass: 36.74 kDa
• AA Sequence: MSMTTRAWEELDGGLGSCQALEDHSALAETQEDRASATPRLADSGSVPHDSQVAEGPSVDTRPKKMEKEPAARGTPGTGKERLKAGASPRSVPARKKAQT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: JSRP1 junctional sarcoplasmic reticulum protein 1 [ Homo sapiens (human) ]
• Official Symbol: JSRP1
• Synonyms: JSRP1; junctional sarcoplasmic reticulum protein 1; JP45; JP-45; junctional sarcoplasmic reticulum protein 1; 2310032K21Rik; homolog of mouse skeletal muscle sarcoplasmic reticulum protein JP-45; junctional-face membrane protein of 45 kDa homolog; skeletal muscle sarcoplasmic reticulum protein JP-45
• Gene ID: 126306
• mRNA Refseq: NM_144616
• Protein Refseq: NP_653217
• MIM: 608743
• UniProt ID: Q96MG2