Recombinant Human ITSN2 Protein, GST-tagged

• Cat.No.: ITSN2-4943H
• Product Overview: Human ITSN2 partial ORF ( NP_006268, 471 a.a. - 571 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a cytoplasmic protein which contains SH3 domains. This protein is a member of a family of proteins involved in clathrin-mediated endocytosis. Intersectin 2 is thought to regulate the formation of clathrin-coated vesicles and also may function in the induction of T cell antigen receptor (TCR) endocytosis. Alternatively spliced transcript variants have been found for this gene that encode three distinct isoforms. Additional variants have been found but their full length nature has not been determined. [provided by RefSeq
• Molecular Mass: 36.85 kDa
• AA Sequence: NQKNREQEEIVRLNSKKKNLHLELEALNGKHQQISGRLQDVRLKKQTQKTELEVLDKQCDLEIMEIKQLQQELQEYQNKLIYLVPEKQLLNERIKNMQFSN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ITSN2 intersectin 2 [ Homo sapiens (human) ]
• Official Symbol: ITSN2
• Synonyms: ITSN2; intersectin 2; SWA; SWAP; SH3D1B; SH3P18; PRO2015; intersectin-2; SH3 domain-containing protein 1B; SH3P18-like WASP-associated protein
• Gene ID: 50618
• mRNA Refseq: NM_001348181
• Protein Refseq: NP_001335110
• MIM: 604464
• UniProt ID: Q9NZM3