Recombinant Human ITM2A Protein, His tagged

• Cat.No.: ITM2A-001H
• Product Overview: Recombinant Human ITM2A Protein (80-263 aa) with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Non
• Protein Length: 80-263 aa
• Description: This gene encodes a type II membrane protein that belongs to the ITM2 family. Studies in mouse suggest that it may be involved in osteo- and chondrogenic differentiation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Molecular Mass: 22 kDa
• Purity: > 90% by SDS-PAGE
• AA Sequence: MPKSTIYRGEMCFFDSEDPANSLRGGEPNFLPVTEEADIREDDNIAIIDVPVPSFSDSDPAAIIHDFEKGMTAYLDLLLGNCYLMPLNTSIVMPPKNLVELFGKLASGRYLPQTYVVREDLVAVEEIRDVSNLGIFIYQLCNNRKSFRLRRRDLLLGFNKRAIDKCWKIRHFPNEFIVETKICQEHHHHHHHH
• Endotoxin: < 1.0 EU/μg by LAL
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4, 8% Trehalose, 10% Glycerol
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: ITM2A integral membrane protein 2A [ Homo sapiens (human) ]
• Official Symbol: ITM2A
• Synonyms: ITM2A; integral membrane protein 2A; E25A; BRICD2A; integral membrane protein 2A; BRICHOS domain containing 2A
• Gene ID: 9452
• mRNA Refseq: NM_004867
• Protein Refseq: NP_004858
• MIM: 300222
• UniProt ID: Q6IBC9