Recombinant Human ITIH4 protein, His-SUMO-tagged

• Cat.No.: ITIH4-4393H
• Product Overview: Recombinant Human ITIH4 protein(Q14624)(689-930aa), fused to N-terminal His-SUMO tag, was expressed in E. coli

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 689-930aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 42.9 kDa
• AA Sequence: RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: ITIH4 inter-alpha-trypsin inhibitor heavy chain family, member 4 [ Homo sapiens ]
• Official Symbol: ITIH4
• Synonyms: ITIH4; inter-alpha-trypsin inhibitor heavy chain family, member 4; inter alpha (globulin) inhibitor H4 (plasma Kallikrein sensitive glycoprotein) , ITIHL1; inter-alpha-trypsin inhibitor heavy chain H4; H4P; IHRP; plasma Kallikrein sensitive glycoprotein; ITI heavy chain H4; inter-alpha-inhibitor heavy chain 4; plasma kallikrein-sensitive glycoprotein 120; inter-alpha-trypsin inhibitor, heavy chain-like, 1; inter-alpha-trypsin inhibitor family heavy chain-related protein; inter-alpha (globulin) inhibitor H4 (plasma Kallikrein-sensitive glycoprotein); GP120; PK120; ITIHL1; PK-120; ITI-HC4; DKFZp686G21125
• Gene ID: 3700
• mRNA Refseq: NM_001166449
• Protein Refseq: NP_001159921
• MIM: 600564
• UniProt ID: Q14624