Recombinant Human ITGBL1 protein, His&Myc-tagged

• Cat.No.: ITGBL1-4335H
• Product Overview: Recombinant Human ITGBL1 protein(O95965)(24-494aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 58.9 kDa
• Protein length: 24-494aa
• AA Sequence: VPQSFSPSLRSWPGAACRLSRAESERRCRAPGQPPGAALCHGRGRCDCGVCICHVTEPGMFFGPLCECHEWVCETYDGSTCAGHGKCDCGKCKCDQGWYGDACQYPTNCDLTKKKSNQMCKNSQDIICSNAGTCHCGRCKCDNSDGSGLVYGKFCECDDRECIDDETEEICGGHGKCYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGVVCGGHGTCSCGRCVCERGWFGKLCQHPRKCNMTEEQSKNLCESADGILCSGKGSCHCGKCICSAEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGWNGNACEIWLGSEYP
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: ITGBL1 integrin, beta-like 1 (with EGF-like repeat domains) [ Homo sapiens ]
• Official Symbol: ITGBL1
• Synonyms: ITGBL1; integrin, beta-like 1 (with EGF-like repeat domains); integrin beta-like protein 1; integrin beta like 1; OSCP; ten integrin EGF like repeat domains protein; TIED; osteoblast-specific cysteine-rich protein; ten integrin EGF-like repeat domains protein; ten integrin EGF-like repeat domain-containing protein
• Gene ID: 9358
• mRNA Refseq: NM_004791
• Protein Refseq: NP_004782
• MIM: 604234
• UniProt ID: O95965