Recombinant Human ITGB2 protein, T7/His-tagged
Cat.No. : | ITGB2-181H |
Product Overview : | Recombinant human CD18 cDNA (23 - 700 aa, derived from BC005861) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 23-700 a.a. |
Form : | 0.20 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFELQECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRP QLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLD DLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQ FQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDN LYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVHLIKNAYNKLSSR VFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQV LPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQ CLCHTSDVPGKLIYGQYCECDTINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQCERTTEGCLNPRRVECS GRGRCRCNVCECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSAACPGLQLSNNPVKGRTCKERD SEGCWVAYTLEQQDGMDRYLIYVDESRECVAGPN |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | ITGB2 integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) [ Homo sapiens ] |
Official Symbol | ITGB2 |
Synonyms | ITGB2; integrin beta-2; LFA 1; MAC 1; integrin beta chain, beta 2; LAD; CD18; MF17; MFI7; LCAMB; LFA-1; MAC-1; |
Gene ID | 3689 |
mRNA Refseq | NM_000211 |
Protein Refseq | NP_000202 |
MIM | 600065 |
UniProt ID | P05107 |
Chromosome Location | 21q22.3 |
Pathway | Adaptive Immune System, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; CXCR3-mediated signaling events, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; |
Function | binding; glycoprotein binding; protein kinase binding; receptor activity; |
◆ Recombinant Proteins | ||
RFL179HF | Recombinant Full Length Human Integrin Beta-2(Itgb2) Protein, His-Tagged | +Inquiry |
ITGB2-26324TH | Recombinant Human ITGB2 | +Inquiry |
ITGB2-71H | Recombinant Human ITGB2 protein, His-tagged | +Inquiry |
ITGB2-4326H | Recombinant Human ITGB2 Protein (Met1-Asn700), C-His tagged | +Inquiry |
ITGB2-5780HF | Recombinant Full Length Human ITGB2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGB2-5125HCL | Recombinant Human ITGB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITGB2 Products
Required fields are marked with *
My Review for All ITGB2 Products
Required fields are marked with *
0
Inquiry Basket